Triple AgonistMost PopularHover to zoomQualified Research Reference
GLP-3(RT)
GLP-3(RT) is documented for controlled research models and literature-based evaluation only.
- Regular
- $159.99
- Elite Member−10%
- $143.99
GLP-3(RT) is an investigational triple receptor agonist targeting GLP-1, GIP, and glucagon pathways, supplied as a lyophilized peptide. Manufactured to research-grade purity.
Research contexts include multi-receptor incretin signaling, energy expenditure modeling, lipolysis, and metabolic pathway characterization.
Research Use Only. This product is intended exclusively for laboratory research and is not approved for human or veterinary use.
GLP-3(RT): investigational profile.
Research Mechanism
A triple agonist targeting GLP-1, GIP, and glucagon receptors, studied to model simultaneous incretin and energy-expenditure signaling. Direct comparison with TIRZ and Semaglutide is standard in the multi-receptor literature.
Investigational Profile
Peer-reviewed data on this class emerged in the early 2020s and remains one of the most actively investigated triple-agonist scaffolds in preclinical metabolism research.
Research Study Window
Study designs commonly observe response across four- to eight-week windows so glucagon-driven lipolytic activity and incretin-driven satiety endpoints can separate cleanly under controlled research conditions.
Ingredients, disclosed.
Every compound and formulation strength documented without proprietary blends.
Composition, documented.
- Molecular Formula
- C221H343N51O64
- Molar Mass
- 4731.4 g/mol
- Amino Acid Sequence
- Y-Aib-QGTFTSDYSIYLDKQAAX-EFVQWLIAGGPSKGIVEQCCTSICSLYQLENYCN (triple agonist backbone)
- Synonyms
- LY3437943, GLP-1/GIP/Glucagon triple agonist
- Solubility
- Water-soluble
- Organoleptic Profile
- White to off-white powder
- Composition
- Lyophilized powder
