Growth-Factor AnalogHover to zoomQualified Research Reference
Growth Factor LR3 (GF-LR3)
Growth Factor LR3 (GF-LR3) is documented for controlled research models and literature-based evaluation only.
- Regular
- $109.99
- Elite Member−10%
- $98.99
GF-LR3 is a modified long-arginine-3 growth-factor analog, supplied as a lyophilized research peptide. Manufactured to a high-purity standard.
Research applications include growth-factor receptor signaling, binding-protein studies, satellite cell activity, and hypertrophy pathway modeling.
Research Use Only. This product is intended exclusively for laboratory research and is not approved for human or veterinary use.
Growth Factor LR3 (GF-LR3): investigational profile.
Research Mechanism
A long-arginine-3 modified growth-factor analog investigated for receptor engagement with reduced binding-protein interference, and for downstream satellite-cell and hypertrophy-pathway signaling. Commonly studied in combined arms with CJC-1295 and Ipamorelin.
Investigational Profile
The long-Arg3 modification has been in the growth-factor literature since the late 1980s and remains the standard analog for isolating receptor-level activity from binding-protein effects.
Research Study Window
Hypertrophy and satellite-cell endpoints are typically evaluated across three- to six-week observation blocks.
Ingredients, disclosed.
Every compound and formulation strength documented without proprietary blends.
Composition, documented.
- Molecular Formula
- C400H625N111O115S9
- Molar Mass
- 9117.4 g/mol
- Amino Acid Sequence
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (Arg3 substitution, N-terminal 13-aa extension)
- Synonyms
- Long-arginine-3 growth-factor analog
- Solubility
- Water-soluble
- Organoleptic Profile
- White to off-white powder
- Composition
- Lyophilized powder
