Amylin AnalogHover to zoomQualified Research Reference
Cagrilintide
Cagrilintide is documented for controlled research models and literature-based evaluation only.
- Regular
- $97.06
- Elite Member−10%
- $87.35
Cagrilintide is a long-acting amylin analog supplied as a lyophilized research peptide. Prepared for laboratory analytical applications.
Studied in amylin receptor pharmacology, satiety signaling, gastric emptying, and combined-incretin research protocols.
Research Use Only. This product is intended exclusively for laboratory research and is not approved for human or veterinary use.
Cagrilintide: investigational profile.
Research Mechanism
A long-acting amylin analog investigated for calcitonin- and amylin-receptor engagement, satiety signaling, and gastric-emptying modulation. Paired research with TIRZ or Semaglutide is common when amylin plus incretin activity is the question.
Investigational Profile
Amylin pharmacology has been in the literature since the 1980s, with long-acting analog work published from the late 2010s onward.
Research Study Window
Long-acting kinetics push observation windows into the six- to twelve-week range, giving amylin-specific satiety and gastric-emptying endpoints time to resolve.
Pairs With
Tirzepatide
Ingredients, disclosed.
Every compound and formulation strength documented without proprietary blends.
Composition, documented.
- Molecular Formula
- C171H271N51O51
- Molar Mass
- 3820.4 g/mol
- Amino Acid Sequence
- KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (K conjugated to C18 diacid)
- Synonyms
- AM-833, long-acting amylin analog
- Solubility
- Water-soluble
- Organoleptic Profile
- White to off-white powder
- Composition
- Lyophilized powder
